PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG166800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bHLH
Protein Properties Length: 95aa    MW: 10385.7 Da    PI: 9.3975
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG166800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH20.68e-0722611554
                         HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                  HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                         +i +  ++L+ llP+a   ++ ++  a +L++++ YI+sL
  Pavir.9KG166800.1.p 22 QISDLVAKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 61
                         789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.106.3E-8578IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.074761IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.4E-91783IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MSSRQSRSRA SSGSTSRIKD EQISDLVAKL QALLPEARLR SNDRVPSARV LQETCSYIRS  60
LHREVDDLSD RLSELLATAD VSTAQAAVIR SLLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8365891e-88CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983143.14e-46PREDICTED: transcription factor ILI7
SwissprotA2Z7301e-44ILI7_ORYSI; Transcription factor ILI7
SwissprotQ338G61e-44ILI7_ORYSJ; Transcription factor ILI7
TrEMBLK4AH624e-46K4AH62_SETIT; Uncharacterized protein
STRINGSi038219m1e-45(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.14e-33bHLH family protein